Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TGFBR1 Protein

This Human TGFBR1 Protein spans the amino acid sequence from region 34-126aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(TGFR-1) (Activin A receptor type II-like protein kinase of 53kD) (Activin receptor-like kinase 5) (ALK-5) (ALK5) (Serine/threonine-protein kinase receptor R4) (SKR4) (TGF-beta type I receptor) (Transforming growth factor-beta receptor type I) (TGF-beta receptor type I) (TbetaR-I)

UniProt

P36897

Expression Region

34-126aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUT-1 Polyclonal Antibody
E-AB-70090-01 60 µL

GLUT-1 Polyclonal Antibody

Sign In for Pricing
View Details
GLUT-1 Polyclonal Antibody
E-AB-70090-02 120 µL

GLUT-1 Polyclonal Antibody

Sign In for Pricing
View Details
GLUT-1 Polyclonal Antibody
E-AB-70090-03 200 µL

GLUT-1 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561119 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
CES2 (Center) Rabbit Polyclonal Antibody
AP50867PU-N 400 µL

CES2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Synapsin1 (Ab-62) Antibody
8B0581-AAT 50 µg

Synapsin1 (Ab-62) Antibody

Sign In for Pricing
View Details