Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human H2BC12 Protein

This Human H2BC12 Protein spans the amino acid sequence from region 2-126aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(H2B K) (HIRA-interacting protein 1)

UniProt

O60814

Expression Region

2-126aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pdk1 AAV siRNA Pooled Vector
36320164 1.0 µg

Pdk1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mammaglobin B antibody
70R-31267 100 ug

Mammaglobin B antibody

Sign In for Pricing
View Details
ABH1 Rabbit pAb, Pacific Blue conjugated
orb2884214 100 µL

ABH1 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Human PIK3C3 Pre-designed siRNA Set A
SI012179A 1 Each

Human PIK3C3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cyanine5 amine, 5 mg
230C0 5 mg

Cyanine5 amine, 5 mg

Sign In for Pricing
View Details
CLCNKB antibody - N-terminal region
MBS3202358-01 0.1 mL

CLCNKB antibody - N-terminal region

Sign In for Pricing
View Details