Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein
Selected Variant
GTR18988866-01
Size: 20 µg
This Legionella pneumophila subsp. pneumophila 50S ribosomal protein L7/L12 Protein spans the amino acid sequence from region 1-126aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
UniProt
Q5ZYQ1
Expression Region
1-126aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Field of Research
Non-Animal
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAVSKNEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAGAGAAAAEEQTEFTVVMTSFGSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGVSKDEAASIKKELEEAGATVEVK
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683141-500 1x 500 µL
SOX9 / SRY-box 9 (SOX9/3141R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
A14920-1-HRP 100 µg/Vial
Anti-PRSS35 Antibody Picoband®, HRP Conjugate
Sign In for Pricing
View Details 
EK2372 96 Well With Removable Strips
Feline IL-8 ELISA Kit PicoKine®
Sign In for Pricing
View Details 
PA1440-APC 100 µg/Vial
Anti-Caspase-1(P20)/CASP1 Antibody Picoband®, APC Conjugate
Sign In for Pricing
View Details 
PA2009-APC 100 µg/Vial
Anti-TRAF4 Antibody Picoband®, APC Conjugate
Sign In for Pricing
View Details 
BNC940521-100 1x 100 µL
AFP (Alpha Fetoprotein) (MBS-12), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details