Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine ADIPOQ Protein

This Equine ADIPOQ Protein spans the amino acid sequence from region 18-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Adiponectin, C1Q and collagen domain containing)

UniProt

F7DZE7

Expression Region

18-244aa

Tag

Tag-Free

Source

E.coli

Origin

Equus caballus (Horse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAVLFTYDQYQDKNLDQASGSVLLYLEKGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA13 Recombinant Protein
OPCD00139-10UG 10 µg

CA13 Recombinant Protein

Sign In for Pricing
View Details
Xpress™ Human RAD51B Over-expressing Stable Cell Line
ABC-X2566 1 Vial

Xpress™ Human RAD51B Over-expressing Stable Cell Line

Sign In for Pricing
View Details
PLV3-CMV-3xMyc-TBC1D14-Puro Plasmid
PVT85100 2 µg

PLV3-CMV-3xMyc-TBC1D14-Puro Plasmid

Sign In for Pricing
View Details
Human Proline-rich protein 11 (PRR11) ELISA Kit
abx540221 96 Tests

Human Proline-rich protein 11 (PRR11) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human HOXB4 shRNA (UAS) - Lentiviral human HOXB4 shRNA (UAS, GFP) plasmid
GTR15134758 1 Vial

Lentiviral human HOXB4 shRNA (UAS) - Lentiviral human HOXB4 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
2,4-dichloro-5-{[ (2-pyridin-2-ylethyl) amino]sulfonyl}benzoic acid
sc-343427 1 g

2,4-dichloro-5-{[ (2-pyridin-2-ylethyl) amino]sulfonyl}benzoic acid

Sign In for Pricing
View Details