Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Equine ADIPOQ Protein

This Equine ADIPOQ Protein spans the amino acid sequence from region 18-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Adiponectin, C1Q and collagen domain containing)

UniProt

F7DZE7

Expression Region

18-244aa

Tag

Tag-Free

Source

E.coli

Origin

Equus caballus (Horse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFSYHITVYLKDVKVSLYKKDKAVLFTYDQYQDKNLDQASGSVLLYLEKGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADI1 Antibody
A60058-100UG 100 µg

ADI1 Antibody

Sign In for Pricing
View Details
USP48 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
49333111 3x 1.0 µg

USP48 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Apc11 (ANAPC11) (NM_001289420) Human Tagged ORF Clone
RG235988 10 µg

Apc11 (ANAPC11) (NM_001289420) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rocks Collection Set
1140500/4 1 Each

Rocks Collection Set

Sign In for Pricing
View Details
CASPR4 CRISPR/Cas9 KO Plasmid (m)
sc-431269 20 µg

CASPR4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), 0.2mg/mL
BNUB2432-500 1x 500 µL

BAP1 (BRCA1 Associated Protein 1) (BAP1/2432), 0.2mg/mL

Sign In for Pricing
View Details