Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bothrops atrox Disintegrin batroxostatin Protein

This Bothrops atrox Disintegrin batroxostatin Protein spans the amino acid sequence from region 1-72aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Disintegrin colombistatin) (Platelet aggregation activation inhibitor)

UniProt

P18618

Expression Region

1-72aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bothrops atrox (Barba amarilla) (Fer-de-lance)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAGEECDCGAPENPCCDAATCKLRPGAQCAEGLCCDQCRFKGAGKICRRARGDNPDDRCTGQSADCPRNRFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leptin (42-56) (Human)
003-16 100 µg

Leptin (42-56) (Human)

Sign In for Pricing
View Details
Halomicin B
orb3024340-01 10 mg

Halomicin B

Sign In for Pricing
View Details
Halomicin B
orb3024340-02 50 mg

Halomicin B

Sign In for Pricing
View Details
PDXK Polyclonal Antibody, Cy5.5 Conjugated
bs-9035R-Cy5.5 100 µL

PDXK Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
NEBExpress Cell-free E. coli Protein Synthesis System
NEB E5360L 100 Reactions

NEBExpress Cell-free E. coli Protein Synthesis System

Sign In for Pricing
View Details
Sympk (BC049852) Mouse Tagged ORF Clone Lentiviral Particle
MR211888L4V 200 µL

Sympk (BC049852) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details