Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOA2 Protein

This Human APOA2 Protein spans the amino acid sequence from region 24-100aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Apo-AII) (ApoA-II) (Apolipoprotein A2)

UniProt

P02652

Expression Region

24-100aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-3-bromobenzonitrile
PEA34460 25 g

2-Amino-3-bromobenzonitrile

Sign In for Pricing
View Details
ANXA9 (ANX31) discontinued
506836 100 µg

ANXA9 (ANX31) discontinued

Sign In for Pricing
View Details
Beclin-1 (Coiled-coil Myosin-like BCL2-interacting Protein, Protein GT197, BECN1, GT197)
030806 100 µL

Beclin-1 (Coiled-coil Myosin-like BCL2-interacting Protein, Protein GT197, BECN1, GT197)

Sign In for Pricing
View Details
Lentiviral mouse Cr2 shRNA (UAS) - Lentiviral mouse Cr2 shRNA (UAS, iRFP) (25)
GTR15260642 1 Vial

Lentiviral mouse Cr2 shRNA (UAS) - Lentiviral mouse Cr2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
FOXP3 Polyclonal Antibody
MBS9246062-01 0.1 mL

FOXP3 Polyclonal Antibody

Sign In for Pricing
View Details
FOXP3 Polyclonal Antibody
MBS9246062-02 5x 0.1 mL

FOXP3 Polyclonal Antibody

Sign In for Pricing
View Details