Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXR1 Protein

This Human FXR1 Protein spans the amino acid sequence from region 123-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FMR1 autosomal homolog 1) (hFXR1p)

UniProt

P51114

Expression Region

123-199aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forceps
2013200 1 Each

Forceps

Sign In for Pricing
View Details
Valyl-tRNA Synthetase (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (HRP)
MBS6505469-01 0.2 mL

Valyl-tRNA Synthetase (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (HRP)

Sign In for Pricing
View Details
Valyl-tRNA Synthetase (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (HRP)
MBS6505469-02 5x 0.2 mL

Valyl-tRNA Synthetase (G7A, Protein G7a, Valine-tRNA ligase, ValRS, VARS1, VARS2) (HRP)

Sign In for Pricing
View Details
TMEM30B Antibody
CSB-PA194152 100 µL

TMEM30B Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561029 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
ICAM-1 Antibody / CD54
V2604SAF-100UG 100 µg

ICAM-1 Antibody / CD54

Sign In for Pricing
View Details