Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXR1 Protein

This Human FXR1 Protein spans the amino acid sequence from region 123-199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(FMR1 autosomal homolog 1) (hFXR1p)

UniProt

P51114

Expression Region

123-199aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CST3 ELISA Kit (Bovine) (OKCD06964)
OKCD06964 96 Well

CST3 ELISA Kit (Bovine) (OKCD06964)

Sign In for Pricing
View Details
XFD647 Anti-human CD22 Antibody *HIB22*
10220180-AAT 100 Tests

XFD647 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
2- (2-Aminobenzoyl) pyridine
FA151907-01 0.05 g

2- (2-Aminobenzoyl) pyridine

Sign In for Pricing
View Details
2- (2-Aminobenzoyl) pyridine
FA151907-02 0.1 g

2- (2-Aminobenzoyl) pyridine

Sign In for Pricing
View Details
Tylosin ELISA Kit
ZKH0028 96 Tests

Tylosin ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TBL34 Polyclonal Antibody
MBS7143450 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TBL34 Polyclonal Antibody

Sign In for Pricing
View Details