Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHRM5 Protein

This Human CHRM5 Protein spans the amino acid sequence from region 215-443aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P08912

Expression Region

215-443aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RIYRETEKRTKDLADLQGSDSVTKAEKRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNPNPSHQMTKRKRVVLVKERKAAQT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX7BP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16722111 3x 1.0 µg

COX7BP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Phospho-Caspase 8 (Tyr380) Colorimetric Cell-Based ELISA Kit (OKAG02087)
OKAG02087 2x 96 Well

Phospho-Caspase 8 (Tyr380) Colorimetric Cell-Based ELISA Kit (OKAG02087)

Sign In for Pricing
View Details
(((9H-Fluoren-9-yl) methoxy) carbonyl) -D-lysine 1000mg
A23378-1000 1000 mg

(((9H-Fluoren-9-yl) methoxy) carbonyl) -D-lysine 1000mg

Sign In for Pricing
View Details
Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit
MBS746080-01 48 Well

Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit
MBS746080-02 96 Well

Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit
MBS746080-03 5x 96 Well

Guinea pig Lysophosphatidylcholine Acyltransferase 4 ELISA Kit

Sign In for Pricing
View Details