Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP2CA Protein

This Human PPP2CA Protein spans the amino acid sequence from region 1-309aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PP2A-alpha) (Replication protein C) (RP-C)

UniProt

P67775

Expression Region

1-309aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD2L1 binding protein (MAD2L1BP) (NM_001003690) Human Tagged Lenti ORF Clone
RC223487L4 10 µg

MAD2L1 binding protein (MAD2L1BP) (NM_001003690) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Matrilin 3 Blocking Peptide
33R-3946 100 ug

Matrilin 3 Blocking Peptide

Sign In for Pricing
View Details
Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
MBS267913-01 48 Well

Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
MBS267913-02 96 Well

Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
MBS267913-03 5x 96 Well

Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details
Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit
MBS267913-04 10x 96 Well

Rat N-Terminal Pro Brain Natriuretic Peptide (NT-ProBNP) ELISA Kit

Sign In for Pricing
View Details