Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC25A6 Protein

This Human SLC25A6 Protein spans the amino acid sequence from region 232-272aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ADP, ATP carrier protein 3) (ADP, ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6)

UniProt

P12236

Expression Region

232-272aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin α1/3/4 (phospho Tyr272) Polyclonal Antibody
RA35706-01 50 µL

Tubulin α1/3/4 (phospho Tyr272) Polyclonal Antibody

Sign In for Pricing
View Details
Tubulin α1/3/4 (phospho Tyr272) Polyclonal Antibody
RA35706-02 100 µL

Tubulin α1/3/4 (phospho Tyr272) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409)
orb2924244-01 20 µg

Recombinant Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409)

Sign In for Pricing
View Details
Recombinant Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409)
orb2924244-02 100 µg

Recombinant Drosophila simulans Adenosine monophosphate-protein transferase FICD homolog (GD23409)

Sign In for Pricing
View Details
OLFM2 siRNA (Rat)
CRR5447-01 15 nmol

OLFM2 siRNA (Rat)

Sign In for Pricing
View Details
OLFM2 siRNA (Rat)
CRR5447-02 30 nmol

OLFM2 siRNA (Rat)

Sign In for Pricing
View Details