Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SLC25A6 Protein

This Human SLC25A6 Protein spans the amino acid sequence from region 232-272aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ADP, ATP carrier protein 3) (ADP, ATP carrier protein, isoform T2) (ANT 2) (Adenine nucleotide translocator 3) (ANT 3) (Solute carrier family 25 member 6)

UniProt

P12236

Expression Region

232-272aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-01 24 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-02 48 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-03 96 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), CF488A conjugate, 0.1mg/mL
BNC881036-500 1x 500 µL

CD41a (ITGA2B/1036), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB08F2-PAG 10x 96 Well Plates

Protein A/G Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
Recombinant Human PS6K/RPS6KB1 Protein (GST Tag)
PKSH031881 50 µg

Recombinant Human PS6K/RPS6KB1 Protein (GST Tag)

Sign In for Pricing
View Details