Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Timp4 Protein

This Mouse Timp4 Protein spans the amino acid sequence from region 30-224aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Tissue inhibitor of metalloproteinases 4) (TIMP-4)

UniProt

Q9JHB3

Expression Region

30-224aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSCAPAHPQQHFCHSALVIRAKISSEKVVPASKDPADTQKLIRYEIKQIKMFKGFEKAKDIQYVYTPFDSSLCGVKLETNSHKQYLLTGQILSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHQNCGCQITTCYAVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGICSWYRGHLHLRKEYVDIIQP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human POLE shRNA (UAS) - Lentiviral human POLE shRNA (UAS, RFP) plasmid
GTR15109237 1 Vial

Lentiviral human POLE shRNA (UAS) - Lentiviral human POLE shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
FOLH1 Antibody
A22173-100UL 100 µL

FOLH1 Antibody

Sign In for Pricing
View Details
MAb to Dengue Virus NS1
MBS313065-01 1 mg

MAb to Dengue Virus NS1

Sign In for Pricing
View Details
MAb to Dengue Virus NS1
MBS313065-02 5x 1 mg

MAb to Dengue Virus NS1

Sign In for Pricing
View Details
LITAF Antibody
MBS5312242-01 0.1 mL

LITAF Antibody

Sign In for Pricing
View Details
LITAF Antibody
MBS5312242-02 5x 0.1 mL

LITAF Antibody

Sign In for Pricing
View Details