Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TusA Protein

This tusA Protein spans the amino acid sequence from region 1-79aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9I3F3

Expression Region

1-79aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTHSVDAILDATGLNCPEPVMMLHNKVRDLAPGGLLKVIATDPSTRRDIPKFCVFLGHELVEQQEEAGTYLYWIRKKAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPM3 (NM_018973) Human Tagged ORF Clone Lentiviral Particle
RC212952L2V 200 µL

DPM3 (NM_018973) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bak (G-10) PE
sc-518146 PE 200 µg/mL

Bak (G-10) PE

Sign In for Pricing
View Details
SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (MaxLight 650) discontinued
041853-ML650 100 µL

SLC25A20, CT (SLC25A20, CAC, CACT, Mitochondrial carnitine/acylcarnitine carrier protein, Carnitine/acylcarnitine translocase, Solute carrier family 25 member 20) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Inhibitor mmu-miR-7224-5p AAV miRNA Vector
Amm3177600 500 ng

Inhibitor mmu-miR-7224-5p AAV miRNA Vector

Sign In for Pricing
View Details
SSX Antibody
OM636569-01 100 µL

SSX Antibody

Sign In for Pricing
View Details
SSX Antibody
OM636569-02 20 µL

SSX Antibody

Sign In for Pricing
View Details