Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Paraphysa scrofa Kappa-theraphotoxin-Ps1b Protein

This Paraphysa scrofa Kappa-theraphotoxin-Ps1b Protein spans the amino acid sequence from region 1-31aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Kappa-TRTX-Ps1b) (PaTX2) (Phrixotoxin-2)

UniProt

P61231

Expression Region

1-31aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Paraphysa scrofa (Chilean copper tarantula) (Phrixotrichus auratus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YCQKWMWTCDEERKCCEGLVCRLWCKRIINM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GDNF Antibody Picoband®, iFluor647 Conjugate
PB9069-iFluor647 100 µg

Anti-GDNF Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
RBM20 Rabbit Polyclonal Antibody (PE)
orb498039 100 µL

RBM20 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Pancreas Tissue Lysate Lyophilized
IMSPCSTLLY200UG 1 Each

Mouse Pancreas Tissue Lysate Lyophilized

Sign In for Pricing
View Details
TMEM158 (C-Term) Rabbit pAb
E2619519 100 µL

TMEM158 (C-Term) Rabbit pAb

Sign In for Pricing
View Details
Syt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6896506 1.0 µg DNA

Syt3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
LMX1B Rabbit pAb
E45R20580N 50 ul

LMX1B Rabbit pAb

Sign In for Pricing
View Details