Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prok2 Protein

This Mouse Prok2 Protein spans the amino acid sequence from region 27-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PK2) (Protein Bv8 homolog)

UniProt

Q9QXU7

Expression Region

27-128aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc finger CCHC domain-containing protein 7 (ZCCHC7) Bovine ELISA Kit
I3182 96 Tests

Zinc finger CCHC domain-containing protein 7 (ZCCHC7) Bovine ELISA Kit

Sign In for Pricing
View Details
MT1F
CSB-CL015112HU 10 μg Plasmid + 200 μL Glycerol

MT1F

Sign In for Pricing
View Details
DSU Rabbit Polyclonal Antibody (BF594)
orb2514721 100 µL

DSU Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
AHR Antibody
orb1533883 50 µg

AHR Antibody

Sign In for Pricing
View Details
MAP4
B6414-10 10 mg

MAP4

Sign In for Pricing
View Details
Ferritin light chain Antibody, mAb, Rabbit
A03764-100 100 µL

Ferritin light chain Antibody, mAb, Rabbit

Sign In for Pricing
View Details