Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prok2 Protein

This Mouse Prok2 Protein spans the amino acid sequence from region 27-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PK2) (Protein Bv8 homolog)

UniProt

Q9QXU7

Expression Region

27-128aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIN TOOL FIXTURE, 96 Well Format, FP4 Series, Double Float Plate, Manual or Multiple Robots
AFIX96FP4 1 EACH

PIN TOOL FIXTURE, 96 Well Format, FP4 Series, Double Float Plate, Manual or Multiple Robots

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)
MBS2074756-01 0.1 mL

APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)
MBS2074756-02 0.2 mL

APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)
MBS2074756-03 0.5 mL

APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)
MBS2074756-04 1 mL

APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)
MBS2074756-05 5 mL

APC-Linked Polyclonal Antibody to B-Cell CLL/Lymphoma 9 (Bcl9)

Sign In for Pricing
View Details