Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Prok2 Protein

This Mouse Prok2 Protein spans the amino acid sequence from region 27-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(PK2) (Protein Bv8 homolog)

UniProt

Q9QXU7

Expression Region

27-128aa

Tag

N-terminal 6xHis-B2M-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dibenz[a, h]anthracene-d14
TMIJ-0404-01 1 mg

Dibenz[a, h]anthracene-d14

Sign In for Pricing
View Details
Dibenz[a, h]anthracene-d14
TMIJ-0404-02 5 mg

Dibenz[a, h]anthracene-d14

Sign In for Pricing
View Details
Exnef Protein Vector (Rat) (pPB-C-His)
PV266766 500 ng

Exnef Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
MC2 receptor/MC2R Rabbit Polyclonal Antibody (APC)
orb2616243 100 µg

MC2 receptor/MC2R Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
RRAGA + RRAGB Antibody Blocking Peptide
orb1515587 500 µg

RRAGA + RRAGB Antibody Blocking Peptide

Sign In for Pricing
View Details
Serine Protease Inhibitor Kazal-type 5 (SPINK5) Human ELISA Kit
G9735 96 Tests

Serine Protease Inhibitor Kazal-type 5 (SPINK5) Human ELISA Kit

Sign In for Pricing
View Details