Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GKN1 Protein

This Human GKN1 Protein spans the amino acid sequence from region 35-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(18 kDa antrum mucosa protein) (AMP-18) (Protein CA11)

UniProt

Q9NS71

Expression Region

35-199aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant IDE Antibody
RC-5765-01 50 μL

Recombinant IDE Antibody

Sign In for Pricing
View Details
Recombinant IDE Antibody
RC-5765-02 100 µL

Recombinant IDE Antibody

Sign In for Pricing
View Details
Recombinant IDE Antibody
RC-5765-03 1 mL

Recombinant IDE Antibody

Sign In for Pricing
View Details
Recombinant Human LAIR2/CD306 Protein (His Tag)
PKSH031383 100 µg

Recombinant Human LAIR2/CD306 Protein (His Tag)

Sign In for Pricing
View Details
TFIIB Recombinant Rabbit Monoclonal Antibody [JE38-37]
HA722213 100 µL

TFIIB Recombinant Rabbit Monoclonal Antibody [JE38-37]

Sign In for Pricing
View Details
C7orf57 (NM_001100159) Human Over-expression Lysate
LY420228 100 µg

C7orf57 (NM_001100159) Human Over-expression Lysate

Sign In for Pricing
View Details