Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGF2R Protein

This Human IGF2R Protein spans the amino acid sequence from region 628-772aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CI Man-6-P receptor) (CI-MPR) (M6PR) (300 kDa mannose 6-phosphate receptor) (MPR 300) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (M6P/IGF2 receptor) (M6P/IGF2R) (CD antigen CD222)

UniProt

P11717

Expression Region

628-772aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPAAT-δ Polyclonal Conjugated Antibody
orb1618706 100 µL

LPAAT-δ Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
3-Chloro-2-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) pyridine
IFC98518-01 100 mg

3-Chloro-2-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) pyridine

Sign In for Pricing
View Details
3-Chloro-2-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) pyridine
IFC98518-02 1 g

3-Chloro-2-methyl-5- (tetramethyl-1,3,2-dioxaborolan-2-yl) pyridine

Sign In for Pricing
View Details
ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)
TRV-0044785-01 24 Tests

ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)

Sign In for Pricing
View Details
ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)
TRV-0044785-02 48 Tests

ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)

Sign In for Pricing
View Details
ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)
TRV-0044785-03 96 Tests

ELISA Kit for Membrane Protein, Palmitoylated 6 (MPP6)

Sign In for Pricing
View Details