Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ANK3 Protein

This Human ANK3 Protein spans the amino acid sequence from region 4088-4199aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ANK-3) (Ankyrin-G)

UniProt

Q12955

Expression Region

4088-4199aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRISPLD1 Protein Vector (Mouse) (pPB-C-His)
PV168066 500 ng

CRISPLD1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CSF1R Polyclonal Antibody, RBITC Conjugated
bs-41371R-RBITC 100 µL

CSF1R Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
MFluor™ Violet 500 Anti-human CD203c Antibody *NP4D6*
12030100-AAT 100 Tests

MFluor™ Violet 500 Anti-human CD203c Antibody *NP4D6*

Sign In for Pricing
View Details
GANC (NM_198141) Human Tagged ORF Clone Lentiviral Particle
RC209301L3V 200 µL

GANC (NM_198141) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Verruculogen (NA 209A, TR 1)
226788 1 mg

Verruculogen (NA 209A, TR 1)

Sign In for Pricing
View Details
Rabbit anti-DGAT2L3 Antibody
DL93343A-01 50 µL

Rabbit anti-DGAT2L3 Antibody

Sign In for Pricing
View Details