Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Daboia palaestinae Disintegrin viperistatin Protein

This Daboia palaestinae Disintegrin viperistatin Protein spans the amino acid sequence from region 1-41aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P0C6E2

Expression Region

1-41aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Daboia palaestinae (Palestine viper) (Vipera palaestinae)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CTTGPCCRQCKLKPAGTTCWKTSRTSHYCTGKSCDCPVYQG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone 3A2]
E45M08932V-2 50 µL

Sonic Hedgehog (SHH) Mouse Monoclonal Antibody [Clone 3A2]

Sign In for Pricing
View Details
MAPK10 Antibody (N-term)
E45R05859G-4 50 µL

MAPK10 Antibody (N-term)

Sign In for Pricing
View Details
Bovine Vitamin E(VE) Elisa kit
MBS2609942-01 48 Well

Bovine Vitamin E(VE) Elisa kit

Sign In for Pricing
View Details
Bovine Vitamin E(VE) Elisa kit
MBS2609942-02 96 Well

Bovine Vitamin E(VE) Elisa kit

Sign In for Pricing
View Details
Bovine Vitamin E(VE) Elisa kit
MBS2609942-03 5x 96 Well

Bovine Vitamin E(VE) Elisa kit

Sign In for Pricing
View Details
Bovine Vitamin E(VE) Elisa kit
MBS2609942-04 10x 96 Well

Bovine Vitamin E(VE) Elisa kit

Sign In for Pricing
View Details