Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine IGF2R Protein

This Bovine IGF2R Protein spans the amino acid sequence from region 628-772aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(CI Man-6-P receptor) (CI-MPR) (M6PR) (300 kDa mannose 6-phosphate receptor) (MPR 300) (Insulin-like growth factor 2 receptor) (Insulin-like growth factor II receptor) (IGF-II receptor) (CD antigen CD222)

UniProt

P08169

Expression Region

628-772aa

Tag

Tag-Free

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS632332 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Arl14epl Mouse Gene Knockout Kit (CRISPR)
KN501566 1 Kit

Arl14epl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human BTB domain containing 5 (KLHL28) activation kit by CRISPRa
GA110280 1 Kit

Human BTB domain containing 5 (KLHL28) activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC140 (NM_153038) Human Recombinant Protein
TP322414 20 µg

CCDC140 (NM_153038) Human Recombinant Protein

Sign In for Pricing
View Details
PGA3 (NM_001079807) Human Over-expression Lysate
LC421542 20 µg

PGA3 (NM_001079807) Human Over-expression Lysate

Sign In for Pricing
View Details
CDY1B Rabbit Polyclonal Antibody
TA374604 100 µL

CDY1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details