Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL2 Protein

This IL2 Protein spans the amino acid sequence from region 21-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

UniProt

Q865X2

Expression Region

21-154aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Lama glama (Llama)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUDT18 (NM_024815) Human Over-expression Lysate
LS079873-100ug 100 µg

NUDT18 (NM_024815) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA1191 (NM_020444) Human Over-expression Lysate
LS057179-20ug 20 µg

KIAA1191 (NM_020444) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral human KRBA1 sgRNA gene knockout kit - Lentiviral human KRBA1 sgRNA gene knockout kit (25)
GTR15376275 1 Vial

Lentiviral human KRBA1 sgRNA gene knockout kit - Lentiviral human KRBA1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SLTM Antibody
CSB-PA296253-01 50 μL

SLTM Antibody

Sign In for Pricing
View Details
SLTM Antibody
CSB-PA296253-02 100 µL

SLTM Antibody

Sign In for Pricing
View Details
Anti-FOXP3 Antibody Picoband® Fluoro647 Conjugated
A00011-3-Fluoro647 100 µg/Vial

Anti-FOXP3 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details