Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL2 Protein

This IL2 Protein spans the amino acid sequence from region 21-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-2) (T-cell growth factor) (TCGF)

UniProt

Q865X2

Expression Region

21-154aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Lama glama (Llama)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APTLSSTKDTKKQLEPLLLDLQFLLKEVNNYENLKLSRMLTFKFYMPKKATELKHLQCLMEELKPLEEVLNLAQSKNSHLTNIKDSMNNINLTVSELKGSETGFTCEYDDETVTVVEFLNKWITFCQSIYSTMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GM2A (Ganglioside GM2 Activator, Cerebroside Sulfate Activator Protein, GM2-AP, Shingolipid Activator Protein 3, SAP-3) (MaxLight 550)
127391-ML550 100 µL

GM2A (Ganglioside GM2 Activator, Cerebroside Sulfate Activator Protein, GM2-AP, Shingolipid Activator Protein 3, SAP-3) (MaxLight 550)

Sign In for Pricing
View Details
3-Methyl-1-phenyl-1H-pyrazolo[3,4-b]pyridine-6-carboxylic acid
ZAC50624-01 50 mg

3-Methyl-1-phenyl-1H-pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
3-Methyl-1-phenyl-1H-pyrazolo[3,4-b]pyridine-6-carboxylic acid
ZAC50624-02 0.5 g

3-Methyl-1-phenyl-1H-pyrazolo[3,4-b]pyridine-6-carboxylic acid

Sign In for Pricing
View Details
LUM Antibody
orb521139-01 50 μL

LUM Antibody

Sign In for Pricing
View Details
LUM Antibody
orb521139-02 100 µL

LUM Antibody

Sign In for Pricing
View Details
CA1 Antibody Blocking peptide
orb1446663 500 µg

CA1 Antibody Blocking peptide

Sign In for Pricing
View Details