Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis angusticeps Dendrotoxin B Protein

This Dendroaspis angusticeps Dendrotoxin B Protein spans the amino acid sequence from region 1-30aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-B)

UniProt

Q9PS09

Expression Region

1-30aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

4.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MICYSHKTPQPSATIGCEEKTCYKKSVRKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-VPS4B antibody
STJ191619 200 µl

Anti-VPS4B antibody

Sign In for Pricing
View Details
NMDA epsilon 1 Polyclonal Antibody, Cy5 Conjugated
bs-7124R-Cy5 100 µL

NMDA epsilon 1 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
4'-Amino Acetophenone For Synthesis
1011290 500 500 g

4'-Amino Acetophenone For Synthesis

Sign In for Pricing
View Details
AICDA Polyclonal Antibody
bs-7855R-TR 20 µL

AICDA Polyclonal Antibody

Sign In for Pricing
View Details
MAS1L Rabbit Polyclonal Antibody (AP)
orb890679 100 µL

MAS1L Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
Human PSA (Free) Matched Antibody Pair Set [Z01LS-0722-LS192]
Z01LS-0722-LS192 5 Plates

Human PSA (Free) Matched Antibody Pair Set [Z01LS-0722-LS192]

Sign In for Pricing
View Details