Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis polylepis polylepis Protease inhibitor dendrotoxin-E Protein

This Dendroaspis polylepis polylepis Protease inhibitor dendrotoxin-E Protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-E) (Venom basic protease inhibitor E)

UniProt

P00984

Expression Region

1-59aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Dendroaspis polylepis polylepis (Black mamba)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF740 conjugate, 0.1mg/mL
BNC742344-500 1x 500 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ROR2 (ROR2/1911), CF640R conjugate, 0.1mg/mL
BNC401911-500 1x 500 µL

ROR2 (ROR2/1911), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
WASP (WAS) Rabbit Polyclonal Antibody
AP06593PU-N 100 µg

WASP (WAS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin
ICH1037-50mg 50 mg

Anti-CD80 (16-10A1) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)
KN205918LP 1 Kit

HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Neurotensin Receptor 1, High Affinity (NTSR1) ELISA Kit
RD-NTSR1-Mu-01 96 Tests

Mouse Neurotensin Receptor 1, High Affinity (NTSR1) ELISA Kit

Sign In for Pricing
View Details