Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

At5g42100 Protein

This At5g42100 Protein spans the amino acid sequence from region 27-425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

((1->3) -beta-glucan endohydrolase 10) ((1->3) -beta-glucanase 10) (Beta-1,3-endoglucanase 10) (Beta-1,3-glucanase 10) (Putative plasmodesmal associated protein) (AtBG_ppap)

UniProt

Q9FHX5

Expression Region

27-425aa

Tag

N-terminal 6xHis-EGFP-tagged

Source

Baculovirus

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

71.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IGINYGQVANNLPPPKNVIPLLKSVGATKVKLYDADPQALRAFAGSGFELTVALGNEYLAQMSDPIKAQGWVKENVQAYLPNTKIVAIVVGNEVLTSNQSALTAALFPAMQSIHGALVDCGLNKQIFVTTAHSLAILDVSYPPSATSFRRDLLGSLTPILDFHVKTGSPILINAYPFFAYEENPKHVSLDFVLFQPNQGFTDPGSNFHYDNMLFAQVDAVYHALDAVGISYKKVPIVVSETGWPSNGDPQEVGATCDNARKYNGNLIKMMMSKKMRTPIRPECDLTIFVFALFNENMKPGPTSERNYGLFNPDGTPVYSLGIKTSSTHSSGSGSSNSTGGSSSGGGGNTGGSSSGGGIYQPVTGNPSPDYMSISSAGGKGRFVECVLFFFLLCIIKLRLKLLQPGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP1 Recombinant Rabbit Monoclonal Antibody [SR41-02]
ET1602-19 100 µL

SHP1 Recombinant Rabbit Monoclonal Antibody [SR41-02]

Sign In for Pricing
View Details
Metconazole
TRC-M225795-5G 5 g

Metconazole

Sign In for Pricing
View Details
Apol7e Mouse Gene Knockout Kit (CRISPR)
KN501432 1 Kit

Apol7e Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FerroBrite™ Green
20205-AAT 1 mg

FerroBrite™ Green

Sign In for Pricing
View Details
4,4'-Dibromobenzophenone
TRC-D425155-25G 25 g

4,4'-Dibromobenzophenone

Sign In for Pricing
View Details
Uncoated Human CD109 (Cluster of Differentiation 109) ELISA Kit
E-UNEL-H0268-01 5x 96 Tests

Uncoated Human CD109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details