Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNTI Protein

This GNTI Protein spans the amino acid sequence from region 25-444aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(N-acetylglucosaminyltransferase I) (GlcNAcT-I) (N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I) (Protein COMPLEX GLYCAN LESS 1)

UniProt

Q9XGM8

Expression Region

25-444aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLFQTQSQYADRLSSAIESENHCTSQMRGLIDEVSIKQSRIVALEDMKNRQDEELVQLKDLIQTFEKKGIAKLTQGGQMPVAAVVVMACSRADYLERTVKSVLTYQTPVASKYPLFISQDGSDQAVKSKSLSYNQLTYMQHLDFEPVVTERPGELTAYYKIARHYKWALDQLFYKHKFSRVIILEDDMEIAPDFFDYFEAAASLMDRDKTIMAASSWNDNGQKQFVHDPYALYRSDFFPGLGWMLKRSTWDELSPKWPKAYWDDWLRLKENHKGRQFIRPEVCRTYNFGEHGSSLGQFFSQYLEPIKLNDVTVDWKAKDLGYLTEGNYTKYFSGLVRQARPIQGSDLVLKAQNIKDDVRIRYKDQVEFERIAGEFGIFEEWKDGVPRTAYKGVVVFRIQTTRRVFLVGPDSVMQLGIRNS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-03 0.02 mg (Yeast)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-04 0.1 mg (Yeast)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details
Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)
MBS1196679-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli O9:H4 Carnitine operon protein CaiE (caiE)

Sign In for Pricing
View Details