Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Classical swine fever virus Genome polyprotein Protein

This Classical swine fever virus Genome polyprotein Protein spans the amino acid sequence from region 690-1028aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q5U8X5

Expression Region

690-1028aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Classical swine fever virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RLACKEDYRYALSSTNEIGLLGAGGLTTTWEEYSHDLQLNDGTVKAICVAGSFKVTALNVVSRRYLASLHKGALLTSVTFELLFDGTNPSTEEMGDDFGFGLCPFDTSPVVKGKYNTTLLNGSAFYLVCPIGWTGVIECTAVSPTTLRTEVVKTFRREKPFPHRMDCVTTTVENEDLFYCKLGGNWTCVKGEPVVYTGGQVKQCKWCGFDFNEPDGLPHYPIGKCILANETGYRIVDSTDCNRDGVVISAEGSHECLIGNTTVKVHASDERLGPMPCRPKEIVSSAGPVRKTSCTFNYAKTLKNKYYEPRDSYFQQYMLKGEYQYWFDLDVTDRHSDYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ras association domain-containing protein 1, RASSF1 ELISA Kit
MBS9321760-01 48 Well

Human Ras association domain-containing protein 1, RASSF1 ELISA Kit

Sign In for Pricing
View Details
Human Ras association domain-containing protein 1, RASSF1 ELISA Kit
MBS9321760-02 96 Well

Human Ras association domain-containing protein 1, RASSF1 ELISA Kit

Sign In for Pricing
View Details
Human Ras association domain-containing protein 1, RASSF1 ELISA Kit
MBS9321760-03 5x 96 Well

Human Ras association domain-containing protein 1, RASSF1 ELISA Kit

Sign In for Pricing
View Details
Human Ras association domain-containing protein 1, RASSF1 ELISA Kit
MBS9321760-04 10x 96 Well

Human Ras association domain-containing protein 1, RASSF1 ELISA Kit

Sign In for Pricing
View Details
VN1R5 Antibody
orb673727-01 50 µg

VN1R5 Antibody

Sign In for Pricing
View Details
VN1R5 Antibody
orb673727-02 100 µg

VN1R5 Antibody

Sign In for Pricing
View Details