Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MGAM Protein

This Human MGAM Protein spans the amino acid sequence from region 87-954aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Alpha-1,4-glucosidase)

UniProt

O43451

Expression Region

87-954aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

101.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGAVSVPWCYYSKNHSYHVEGNLVNTNAGFTARLKNLPSSPVFGSNVDNVLLTAEYQTSNRFHFKLTDQTNNRFEVPHEHVQSFSGNAAASLTYQVEISRQPFSIKVTRRSNNRVLFDSSIGPLLFADQFLQLSTRLPSTNVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGNGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMEVVLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYEYGTLDNMREVVERNRAAQLPYDVQHADIDYMDERRDFTYDSVDFKGFPEFVNELHNNGQKLVIIVDPAISNNSSSSKPYGPYDRGSDMKIWVNSSDGVTPLIGEVWPGQTVFPDYTNPNCAVWWTKEFELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTNNLNNPPFTPRILDGYLFCKTLCMDAVQHWGKQYDIHNLYGYSMAVATAEAAKTVFPNKRSFILTRSTFAGSGKFAAHWLGDNTATWDDLRWSIPGVLEFNLFGIPMVGPDICGFALDTPEELCRRWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFFRAHSRGDTVARPLLHEFYEDNSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYVPDAVWYDYETGSQVRWRKQKVEMELPGDKIGLHLRGGYIFPTQQPNTTTLASRKNPLGLIIALDENKEAKGELFWDNGETKDTVANKVYLLCEFSVTQNRLEVNISQSTYKDPNNLAFNEIKILGTEEPSNVTVKHNGVPSQTSPTVTYDSNLKVAIITDIDLLLGEAYTVEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VIPR2 Antibody (N-term)
MBS9210915-01 0.08 mL

VIPR2 Antibody (N-term)

Sign In for Pricing
View Details
VIPR2 Antibody (N-term)
MBS9210915-02 0.4 mL

VIPR2 Antibody (N-term)

Sign In for Pricing
View Details
VIPR2 Antibody (N-term)
MBS9210915-03 5x 0.4 mL

VIPR2 Antibody (N-term)

Sign In for Pricing
View Details
XPNPEP3, CT (XPNPEP3, Probable Xaa-Pro aminopeptidase 3, Aminopeptidase P3) (Azide free) (HRP)
MBS6364021-01 0.2 mL

XPNPEP3, CT (XPNPEP3, Probable Xaa-Pro aminopeptidase 3, Aminopeptidase P3) (Azide free) (HRP)

Sign In for Pricing
View Details
XPNPEP3, CT (XPNPEP3, Probable Xaa-Pro aminopeptidase 3, Aminopeptidase P3) (Azide free) (HRP)
MBS6364021-02 5x 0.2 mL

XPNPEP3, CT (XPNPEP3, Probable Xaa-Pro aminopeptidase 3, Aminopeptidase P3) (Azide free) (HRP)

Sign In for Pricing
View Details
FREQ, NT (NCS1, FLUP, FREQ, Neuronal calcium sensor 1, Frequenin homolog, Frequenin-like protein, Frequenin-like ubiquitous protein) (Azide free) (HRP) discontinued
035766-HRP 200 µL

FREQ, NT (NCS1, FLUP, FREQ, Neuronal calcium sensor 1, Frequenin homolog, Frequenin-like protein, Frequenin-like ubiquitous protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details