Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human QPCT Protein

This Human QPCT Protein spans the amino acid sequence from region 29-361aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glutaminyl cyclase) (QC) (sQC) (Glutaminyl-tRNA cyclotransferase) (Glutamyl cyclase) (EC)

UniProt

Q16769

Expression Region

29-361aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECI Overexpression Lysate (Native) - (Dry Ice)
NBL1-14275 0.1 mg

PECI Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Sulfur 10 ug/g (10 PPM) for AA and ICP 100 grams in no.2 Diesel Fuel
SDFS-10-Y 100 mL

Sulfur 10 ug/g (10 PPM) for AA and ICP 100 grams in no.2 Diesel Fuel

Sign In for Pricing
View Details
SLC38A4 sgRNA CRISPR Lentivector (Human) (Target 1)
K2188602 1.0 µg DNA

SLC38A4 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Itpripl1 (NM_001163528) Mouse Tagged ORF Clone
MR217249 10 µg

Itpripl1 (NM_001163528) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
GLI2 Antibody / GLI family zinc finger protein 2
RQ8264 100 µg

GLI2 Antibody / GLI family zinc finger protein 2

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5 (SCAMP5), partial
MBS7090380 Inquire

Recombinant Oryza sativa subsp. japonica Secretory carrier-associated membrane protein 5 (SCAMP5), partial

Sign In for Pricing
View Details