Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E Protein

This Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E Protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-E) (Venom basic protease inhibitor E)

UniProt

P00984

Expression Region

1-59aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Dendroaspis polylepis polylepis (Black mamba)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PVRL1/NECTIN1 Antibody Pair Set
ABPR-ZB207 5 plates, 15 plates

Human PVRL1/NECTIN1 Antibody Pair Set

Sign In for Pricing
View Details
Olr736 3'UTR Lenti-reporter-Luc Vector
34640086 1.0 µg

Olr736 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (MaxLight 750) discontinued
125221-ML750 100 µL

COPB (Coatomer Subunit beta, Beta-coat Protein, Beta-COP, COPB1, MSTP026) (MaxLight 750) discontinued

Sign In for Pricing
View Details
GFRA2 Conjugated Antibody
orb1625943 100 µL

GFRA2 Conjugated Antibody

Sign In for Pricing
View Details
HIST1H2BJ 3'UTR Luciferase Stable Cell Line
TU009832 1.0 mL

HIST1H2BJ 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
trans-Ned 19
B7550-5 5 mg

trans-Ned 19

Sign In for Pricing
View Details