Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E Protein

This Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E Protein spans the amino acid sequence from region 1-59aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-E) (Venom basic protease inhibitor E)

UniProt

P00984

Expression Region

1-59aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Dendroaspis polylepis polylepis (Black mamba)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STAB2 Pre-designed siRNA Set A
SI015876A 1 Each

Human STAB2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Gls Rat shRNA Plasmid (Locus ID 24398)
TR709213 1 Kit

Gls Rat shRNA Plasmid (Locus ID 24398)

Sign In for Pricing
View Details
Recombinant Mouse ORMDL3 Protein, His (Fc)-Avi-tagged
ORMDL3-6410M 50 µg

Recombinant Mouse ORMDL3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Alpha-sarcoglycan Antibody
E51A01062 100 µL

Alpha-sarcoglycan Antibody

Sign In for Pricing
View Details
Donkey Peroxisome Assembly Factor 2 (PEX6) ELISA Kit
MBS9932408 Inquire

Donkey Peroxisome Assembly Factor 2 (PEX6) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [Alexa Fluor 405]
NBP2-47812AF405 0.1 mL

Mouse Monoclonal CD47 Antibody (IAP/964 + B6H12.2) [Alexa Fluor 405]

Sign In for Pricing
View Details