Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THI2.3 Protein

This THI2.3 Protein spans the amino acid sequence from region 1-46aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P32880

Expression Region

1-46aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Viscum album (European mistletoe)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCCPNTTGRNIYNTCRFGGGSREVCASLSGCKIISASTCPSYPDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOMO1, ID (Nodal Modulator 1, pM5, PM5)
N3019-30B 200 µL

NOMO1, ID (Nodal Modulator 1, pM5, PM5)

Sign In for Pricing
View Details
Lentiviral human NPIPB2 sgRNA gene knockout kit - Lentiviral human NPIPB2 sgRNA gene knockout kit (plasmid)
GTR15356606 1 Vial

Lentiviral human NPIPB2 sgRNA gene knockout kit - Lentiviral human NPIPB2 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Elongation factor P (efp)
MBS1044850-01 0.02 mg (E-Coli)

Recombinant Helicobacter pylori Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Elongation factor P (efp)
MBS1044850-02 0.1 mg (E-Coli)

Recombinant Helicobacter pylori Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Elongation factor P (efp)
MBS1044850-03 0.02 mg (Yeast)

Recombinant Helicobacter pylori Elongation factor P (efp)

Sign In for Pricing
View Details
Recombinant Helicobacter pylori Elongation factor P (efp)
MBS1044850-04 0.1 mg (Yeast)

Recombinant Helicobacter pylori Elongation factor P (efp)

Sign In for Pricing
View Details