Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dendroaspis angusticeps Dendrotoxin B Protein

This Dendroaspis angusticeps Dendrotoxin B Protein spans the amino acid sequence from region 1-30aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(DTX-B)

UniProt

Q9PS09

Expression Region

1-30aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MICYSHKTPQPSATIGCEEKTCYKKSVRKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL28 Antibody, HRP conjugated
CSB-PA020217EB01HU-01 50 µg

RPL28 Antibody, HRP conjugated

Sign In for Pricing
View Details
RPL28 Antibody, HRP conjugated
CSB-PA020217EB01HU-02 100 µg

RPL28 Antibody, HRP conjugated

Sign In for Pricing
View Details
1110012J17Rik Protein Vector (Mouse) (pPB-C-His)
PV146298 500 ng

1110012J17Rik Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant Human UBTFL1 Protein
E30P7611 20 µg

Recombinant Human UBTFL1 Protein

Sign In for Pricing
View Details
IL22RA2, NT (IL22RA2, Interleukin-22 receptor subunit alpha-2, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, Interleukin-22-binding protein, ZcytoR16) (PE)
MBS6310112-01 0.2 mL

IL22RA2, NT (IL22RA2, Interleukin-22 receptor subunit alpha-2, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, Interleukin-22-binding protein, ZcytoR16) (PE)

Sign In for Pricing
View Details
IL22RA2, NT (IL22RA2, Interleukin-22 receptor subunit alpha-2, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, Interleukin-22-binding protein, ZcytoR16) (PE)
MBS6310112-02 5x 0.2 mL

IL22RA2, NT (IL22RA2, Interleukin-22 receptor subunit alpha-2, Cytokine receptor class-II member 10, Cytokine receptor family 2 member 10, Cytokine receptor family type 2, soluble 1, Interleukin-22-binding protein, ZcytoR16) (PE)

Sign In for Pricing
View Details