Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LRP2 Protein

This Human LRP2 Protein spans the amino acid sequence from region 1186-1389aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LRP-2) (Glycoprotein 330) (gp330) (Megalin)

UniProt

P98164

Expression Region

1186-1389aa

Tag

C-terminal mFc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOM (Apolipoprotein M, Apo-M, ApoM, Protein G3a, G3A, NG20, HSPC336) (MaxLight 650)
123446-ML650 100 µL

APOM (Apolipoprotein M, Apo-M, ApoM, Protein G3a, G3A, NG20, HSPC336) (MaxLight 650)

Sign In for Pricing
View Details
Nicotinamide N-methyltransferase, 1-264aa, Recombinant, Human, His-Tag (NNMT)
N2561-70A-01 100 µg

Nicotinamide N-methyltransferase, 1-264aa, Recombinant, Human, His-Tag (NNMT)

Sign In for Pricing
View Details
Nicotinamide N-methyltransferase, 1-264aa, Recombinant, Human, His-Tag (NNMT)
N2561-70A-02 500 µg

Nicotinamide N-methyltransferase, 1-264aa, Recombinant, Human, His-Tag (NNMT)

Sign In for Pricing
View Details
Anti-Sel-1L Antibody
CQA2636-01 30 µL

Anti-Sel-1L Antibody

Sign In for Pricing
View Details
Anti-Sel-1L Antibody
CQA2636-02 50 μL

Anti-Sel-1L Antibody

Sign In for Pricing
View Details
Anti-Sel-1L Antibody
CQA2636-03 100 µL

Anti-Sel-1L Antibody

Sign In for Pricing
View Details