Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Nptx1 Protein

This Mouse Nptx1 Protein spans the amino acid sequence from region 23-432aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(NP1) (Neuronal pentraxin I) (NP-I)

UniProt

Q62443

Expression Region

23-432aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

73.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDFGPTRFICTSVPVDADMCAASVAAGGAEELRSNVLQLRETVLQQKETILSQKETIRELTTKLGRCESQSTLDSGPGEARSGGGRKQPGSGKNTMGDLSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDDLERQVLSRVNTLEEGKGGPKNDTEERAKIESALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMYAKVKKSLPEMYAFTVCMWLKSSAAPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKVAKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGNGENLAPYHPIKPQGVLVLGQEQDTLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSSKALSGNVIAWAESQIEIFGGATKWTFEACRQIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit
MBS706294-01 24 Well (LIMIT 1)

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit

Sign In for Pricing
View Details
Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit
MBS706294-02 48 Well

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit

Sign In for Pricing
View Details
Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit
MBS706294-03 96 Well

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit

Sign In for Pricing
View Details
Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit
MBS706294-04 5x 96 Well

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit

Sign In for Pricing
View Details
Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit
MBS706294-05 10x 96 Well

Mouse pro interleukin 1 beta, pro-IL1B ELISA Kit

Sign In for Pricing
View Details
Recombinant Cynomolgus CD226 Protein
orb2993000-01 10 µg

Recombinant Cynomolgus CD226 Protein

Sign In for Pricing
View Details