Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cthrc1 Protein

This Mouse Cthrc1 Protein spans the amino acid sequence from region 33-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9D1D6

Expression Region

33-245aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UTY Antibody, HRP conjugated
A38203-100UG 100 µg

UTY Antibody, HRP conjugated

Sign In for Pricing
View Details
Inhbc siRNA Oligos set (Rat)
24968176 3x 5 nmol

Inhbc siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Human TNF alpha ELISA Kit, 1 x 96-well (pre-coated)
EA102164 1x 96 Well (Pre-Coated)

Human TNF alpha ELISA Kit, 1 x 96-well (pre-coated)

Sign In for Pricing
View Details
Regucalcin (RGN) (NM_004683) Human Tagged ORF Clone Lentiviral Particle
RC218430L3V 200 µL

Regucalcin (RGN) (NM_004683) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LIN7A Antibody
E309998 200 µL

LIN7A Antibody

Sign In for Pricing
View Details
Recombinant Pichia pastoris Pheromone-processing carboxypeptidase KEX1 (KEX1), partial
MBS1055257 Inquire

Recombinant Pichia pastoris Pheromone-processing carboxypeptidase KEX1 (KEX1), partial

Sign In for Pricing
View Details