Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cthrc1 Protein

This Mouse Cthrc1 Protein spans the amino acid sequence from region 33-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9D1D6

Expression Region

33-245aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SENPKVKQKALIRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sofituzumab Biosimilar - Research Grade
ICH5086-1mg 1 mg

Sofituzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Nfe2l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4422505 3x 1.0 µg

Nfe2l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
ID4 Polyclonal Antibody, Cy5 Conjugated
bs-6669R-Cy5 100 µL

ID4 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
IGFBP1 Antibody [P3H15]
C15787-100uL*2 2x 100μL

IGFBP1 Antibody [P3H15]

Sign In for Pricing
View Details
Gabrb1 (NM_012956) Rat Tagged ORF Clone Lentiviral Particle
RR204313L4V 200 µL

Gabrb1 (NM_012956) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Cluster of differentiation 32 (CD32) ELISA Kit
YP-W24811-01 48 Tests

Mouse Cluster of differentiation 32 (CD32) ELISA Kit

Sign In for Pricing
View Details