Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Lilrb3 Protein

This Mouse Lilrb3 Protein spans the amino acid sequence from region 25-642aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(LIR-3) (Leukocyte immunoglobulin-like receptor 3) (Cell-surface glycoprotein p91) (Paired immunoglobulin-like receptor B) (PIR-B)

UniProt

P97484

Expression Region

25-642aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

70.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEATR2 AAV Vector (Mouse) (CMV)
23158104 1 µg

HEATR2 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
RPA34 (RPA2) (NM_002946) Human Tagged ORF Clone Lentiviral Particle
RC205715L1V 200 µL

RPA34 (RPA2) (NM_002946) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
3-Phenyl-2-propen-1-ol
MBS5786936 Inquire

3-Phenyl-2-propen-1-ol

Sign In for Pricing
View Details
MRGX1 Rabbit Polyclonal Antibody (APC-Cy7)
orb2399404 100 µL

MRGX1 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
C5a anaphylatoxin Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-0324R-BF594-TR 20 µL

C5a anaphylatoxin Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
ELISA Kit For Nitric oxide synthase, brain
E0628h 96 Tests

ELISA Kit For Nitric oxide synthase, brain

Sign In for Pricing
View Details