Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE7 Protein

This Human RNASE7 Protein spans the amino acid sequence from region 29-156aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(RNase 7) (Skin-derived antimicrobial protein 2) (SAP-2)

UniProt

Q9H1E1

Expression Region

29-156aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Camel IL-15 ELISA Kit
GR242024 96 Well

Nori® Camel IL-15 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Follistatin Antibody (FST/4282) [HRP]
NBP3-08814H 100 µL

Mouse Monoclonal Follistatin Antibody (FST/4282) [HRP]

Sign In for Pricing
View Details
Protein B1 (B1) Antibody (FITC)
abx317797-01 20 µg

Protein B1 (B1) Antibody (FITC)

Sign In for Pricing
View Details
Protein B1 (B1) Antibody (FITC)
abx317797-02 50 µg

Protein B1 (B1) Antibody (FITC)

Sign In for Pricing
View Details
Protein B1 (B1) Antibody (FITC)
abx317797-03 100 µg

Protein B1 (B1) Antibody (FITC)

Sign In for Pricing
View Details
Protein B1 (B1) Antibody (FITC)
abx317797-04 200 µg

Protein B1 (B1) Antibody (FITC)

Sign In for Pricing
View Details