Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Atp1b1 Protein

This Mouse Atp1b1 Protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Sodium/potassium-dependent ATPase subunit beta-1)

UniProt

P14094

Expression Region

1-304aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS-

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human RAB2A shRNA (UAS) - Lentiviral human RAB2A shRNA (UAS, RFP) (100)
GTR15319959 1 Vial

Lentiviral human RAB2A shRNA (UAS) - Lentiviral human RAB2A shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Anti-GTF2H2C Antibody (C-term)
A19016-1-01 80 µL

Anti-GTF2H2C Antibody (C-term)

Sign In for Pricing
View Details
Anti-GTF2H2C Antibody (C-term)
A19016-1-02 400 µL

Anti-GTF2H2C Antibody (C-term)

Sign In for Pricing
View Details
Anti-DNA Antibody (5G12-4)
RGK23936 100 μg

Anti-DNA Antibody (5G12-4)

Sign In for Pricing
View Details
SF3B4 Rabbit Polyclonal Antibody (HRP)
orb2125238 100 µL

SF3B4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Canine Septin 5 ELISA Kit
MBS077194-01 48 Well

Canine Septin 5 ELISA Kit

Sign In for Pricing
View Details