Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Atp1b1 Protein

This Mouse Atp1b1 Protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Sodium/potassium-dependent ATPase subunit beta-1)

UniProt

P14094

Expression Region

1-304aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS-

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFSD Antibody (N-term)
orb1933806-01 50 µL

MTHFSD Antibody (N-term)

Sign In for Pricing
View Details
MTHFSD Antibody (N-term)
orb1933806-02 100 µL

MTHFSD Antibody (N-term)

Sign In for Pricing
View Details
ZNRD2 Human Over-expression Lysate
orb1347004 100 µg

ZNRD2 Human Over-expression Lysate

Sign In for Pricing
View Details
CDK10 siRNA (Human)
orb1862631-01 15 nmol

CDK10 siRNA (Human)

Sign In for Pricing
View Details
CDK10 siRNA (Human)
orb1862631-02 30 nmol

CDK10 siRNA (Human)

Sign In for Pricing
View Details
ZMYM6 Antibody
orb1266678 400 μl

ZMYM6 Antibody

Sign In for Pricing
View Details