Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CCRL2 Protein

This Human CCRL2 Protein spans the amino acid sequence from region 1-344aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Chemokine receptor CCR11) (Chemokine receptor X) (Putative MCP-1 chemokine receptor)

UniProt

O00421

Expression Region

1-344aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine GHRL ELISA Kit
EF016750 96 Tests

Porcine GHRL ELISA Kit

Sign In for Pricing
View Details
MTH1 (NUDT1) (NM_198950) Human Tagged ORF Clone
RC212761 10 µg

MTH1 (NUDT1) (NM_198950) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cyclohexanecarboxylic acid
445293-01 500 mg

Cyclohexanecarboxylic acid

Sign In for Pricing
View Details
Cyclohexanecarboxylic acid
445293-02 1 g

Cyclohexanecarboxylic acid

Sign In for Pricing
View Details
Recombinant Human CD268/TNFRSF13C Protein, N-His
orb2967452-01 50 µg

Recombinant Human CD268/TNFRSF13C Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD268/TNFRSF13C Protein, N-His
orb2967452-02 100 µg

Recombinant Human CD268/TNFRSF13C Protein, N-His

Sign In for Pricing
View Details