Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ATP5J2 Protein

This Human ATP5J2 Protein spans the amino acid sequence from region 1-94aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ATP synthase membrane subunit f)

UniProt

P56134

Expression Region

1-94aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taccalonolide C
MBS5799193 Inquire

Taccalonolide C

Sign In for Pricing
View Details
VAMP2 Antibody [M16L18]
C21397-100uL*2 2x 100μL

VAMP2 Antibody [M16L18]

Sign In for Pricing
View Details
Mouse D7Ertd443e activation kit by CRISPRa
GA208697 1 Kit

Mouse D7Ertd443e activation kit by CRISPRa

Sign In for Pricing
View Details
ACTB (Actin, Cytoplasmic 1, Beta-actin) (HRP)
122916-HRP 100 µL

ACTB (Actin, Cytoplasmic 1, Beta-actin) (HRP)

Sign In for Pricing
View Details
Rat Fbxl19 Pre-designed siRNA Set B
SI204918B 1 Each

Rat Fbxl19 Pre-designed siRNA Set B

Sign In for Pricing
View Details
GDA Antibody - middle region : FITC (ARP63054_P050-FITC)
ARP63054_P050-FITC 100 µL

GDA Antibody - middle region : FITC (ARP63054_P050-FITC)

Sign In for Pricing
View Details