Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Cmklr2 Protein

This Rat Cmklr2 Protein spans the amino acid sequence from region 1-353aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Chemerin chemokine-like receptor 2) (Chemokine-like receptor 2) (G-protein coupled receptor 1)

UniProt

P46090

Expression Region

1-353aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVSREMLFEELDNYSYALEYYSQEPDAEENVYPGIVHWISLLLYALAFVLGIPGNAIVIWFMGFKWKKTVTTLWFLNLAIADFVFVLFLPLYISYVALSFHWPFGRWLCKLNSFIAQLNMFSSVFFLTVISLDRYIHLIHPGLSHPHRTLKNSLLVVLFVWLLASLLGGPTLYFRDTVEVNNRIICYNNFQEYELTLMRHHVLTWVKFLFGYLLPLLTMSSCYLCLIFKTKKQNILISSKHLWMILSVVIAFMVCWTPFHLFSIWELSIHHNSSFQNVLQGGIPLSTGLAFLNSCLNPILYVLISKKFQARFRASVAEVLKRSLWEASCSGTVSEQLRSAETKSLSLLETAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Phospholipase A2, Secreted ELISA Kit
MBS035510-01 48 Well

Hamster Phospholipase A2, Secreted ELISA Kit

Sign In for Pricing
View Details
Hamster Phospholipase A2, Secreted ELISA Kit
MBS035510-02 96 Well

Hamster Phospholipase A2, Secreted ELISA Kit

Sign In for Pricing
View Details
Hamster Phospholipase A2, Secreted ELISA Kit
MBS035510-03 5x 96 Well

Hamster Phospholipase A2, Secreted ELISA Kit

Sign In for Pricing
View Details
Hamster Phospholipase A2, Secreted ELISA Kit
MBS035510-04 10x 96 Well

Hamster Phospholipase A2, Secreted ELISA Kit

Sign In for Pricing
View Details
DAPK2 Protein (N-GST, Human)
P523813 100 µg

DAPK2 Protein (N-GST, Human)

Sign In for Pricing
View Details
EDA-GDP-BDP-FL
NU-840-BDP 50 μL

EDA-GDP-BDP-FL

Sign In for Pricing
View Details