Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifi27l2a Protein

This Mouse Ifi27l2a Protein spans the amino acid sequence from region 25-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Interferon-stimulated gene 12 protein) (ISG12)

UniProt

Q8R412

Expression Region

25-90aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SMIM15 sgRNA gene knockout kit - Lentiviral human SMIM15 sgRNA gene knockout kit (plasmid)
GTR15358799 1 Vial

Lentiviral human SMIM15 sgRNA gene knockout kit - Lentiviral human SMIM15 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
MFSD7 Lentiviral Activation Particles (h2)
sc-410190-LAC-2 200 µL

MFSD7 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Plasmodium Falciparum Tubulin alpha chain Protein (aa 1-453)
VAng-Wyb6882-500gEcoli 500 µg (E. coli)

Recombinant Plasmodium Falciparum Tubulin alpha chain Protein (aa 1-453)

Sign In for Pricing
View Details
PIK3AP1 Detection Antibody
OAOA22250-50UG 50 µg

PIK3AP1 Detection Antibody

Sign In for Pricing
View Details
Escitalopram
C03442-25mg 25 mg

Escitalopram

Sign In for Pricing
View Details
COG2 (NM_007357) Human Over-expression Lysate
LY402136 100 µg

COG2 (NM_007357) Human Over-expression Lysate

Sign In for Pricing
View Details