Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ifi27l2a Protein

This Mouse Ifi27l2a Protein spans the amino acid sequence from region 25-90aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Interferon-stimulated gene 12 protein) (ISG12)

UniProt

Q8R412

Expression Region

25-90aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

7.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0691706 1.0 µg DNA

ERCC8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Hexamide
HY-124555 1 Each

Hexamide

Sign In for Pricing
View Details
Human MAN1A2 siRNA
abx923372-01 15 nmol

Human MAN1A2 siRNA

Sign In for Pricing
View Details
Human MAN1A2 siRNA
abx923372-02 30 nmol

Human MAN1A2 siRNA

Sign In for Pricing
View Details
Recombinant Bovine Growth/Differentiation Factor 8 (MSTN), N-His
AP9C429-01 1 mg

Recombinant Bovine Growth/Differentiation Factor 8 (MSTN), N-His

Sign In for Pricing
View Details
Recombinant Bovine Growth/Differentiation Factor 8 (MSTN), N-His
AP9C429-02 10 µg

Recombinant Bovine Growth/Differentiation Factor 8 (MSTN), N-His

Sign In for Pricing
View Details